Synonyms and Antonyms for Cadaster

Following is a list of 150 synonym words and phrases that are related to cadaster:

Filter Results

4 Letter Words

gridlandplatsarttopogoreplotfarmshedlinepartacreclaycapemarkyard

5 Letter Words

trackcairnsweepbasinchartbaulkearthswathwaste

6 Letter Words

surveytetradcommonbunderspreadlayoutgroundhectadcawniemorgenscreed

7 Letter Words

basemapquadratterrainseveralreserveeastingacreagecontreecatastacountrycutlinegeodatasondageterriertillagesectionferdingairshedcartwaygroundscutovercontourlandusemereingmacadam

8 Letter Words

cadastregasfieldlandbookacredaleclearagelocationtownsitecountreeplowlandtractletchainagegeochartplowgatelandmassbordlandplotlandscattaldallodiumfarmlandseedplotbassettalandholdlandskipfrontagewalkoverloanlandcreekbed

9 Letter Words

cadastralland takeland markfarm landgeosurveyland massland-massgraveyardcontinentgrid roadcrop markdatascapelandscapepasturageland-grabgeographyplacemarkallotmentgraticulecatchmentterritorywaterbodyland-takeforedraftsandveldtcommonageagistmentworld mapgreenbelttablelandballybeto

10 Letter Words

topographystreet maprelief mapgroundplanwater-shedexcavationwaterfrontbattle map

11 Letter Words

contour maplocator mapgeodatabasepanellationgroundcovercountrysidelandholdingcommon land

12 Letter Words

yard of landphysical mapcenturiationtreasure map

13 Letter Words

building sitetract of landburial groundcrosshatchingpublic domain

14 Letter Words

grid reference

15 Letter Words

lay of the landshooting rightslie of the land

16 Letter Words

metes and bounds

17 Letter Words

topographical map

Using this list of similar-meaning words, you can choose the best synonyms to replace cadaster in your sentences.

Additionally, you'll find antonyms included, perfect for when you need the complete opposite meaning of cadaster in your writing.